Label Worx

Top
Distribution
Distribution
Promo Worx
Promo Worx
Royalty Worx
Royalty Worx
Mix & Master
Mix & Master
Demo Worx
Demo Worx
Web Services
Web Services

LABEL WORX

Digital music services for independent record labels

Label Worx is the leading provider of services to independent record labels worldwide. We are the backbone of many of the industries leading brands, helping them to free up valuable time and resources that enables them to concentrate on what really matters, the Music!

 

Latest News

News from the industry, record labels, artists and Label Worx

Are you collecting your Neighboring Rights?

Our News   /   May 11th, 2016

Are you collecting your Neighboring Rights?

Neighbouring Rights is one of the fastest growing revenue streams in music. If your labels recordings have been broadcast on radio, TV, in a public place such as a bar or restaurant, or on new media somewhere in the world, then there is revenue waiting for you. Label Worx have teamed up with Lime Blue Music who specialises in the worldwide management, collection and distribution of Neighbouring Rights. They are already working with labels such as Juicy Music, Enhanced, Little Helpers, Electronique, Criminal Hype plus many more. They are looking to expand their roster and if you are interested in signing up or would like more info please check out the website http://www.limebluemusic.com/ or email info@limebluemusic.com

OFF Recordings join the Label Worx family

Label News   /   June 20th, 2016

OFF Recordings join the Label Worx family

Over the last 12 months, Label Worx has built even more concrete foundations within the industry and cemented it's self as the 'World's largest distributor of dance music'. This leads us on to one of our latest acquisitions, OFF Recordings. Headed up by front man Andre Crom, OFF is a staple brand in the underground house, tech house and techno scene. Featuring a catalogue of over 170 releases, from artists such as Jay Lumen, Ourole Disco Machine, Robosonic, Marlon Hoffstadt, Vanilla Ace and a whole lot more. OFF Continues to be one of the finest and largest names in the scene with a heavyweight schedule ahead for 2016. The latest release on OFF Recordings is 'Andre Crom - Sequence EP' and is available now on Beatport.

South West Four have set up a petition to try and get Carl Cox an MBE

Industry News   /   June 19th, 2016

South West Four have set up a petition to try and get Carl Cox an MBE

Carl Cox is a national treasure. A global icon. A living legend for fans of electronic music from across the world. Today we reach out to all music lovers and ask them to sign this petition to get Carl nominated as an MBE in the 2017 New Years Honours list. 2016 represents the eighth year Carl has played South West Four. Carl has never failed to inspire his fellow DJs, our staff and most importantly the thousands of people in front of him each and every time he has played our event. His energy knows no bounds and his passion for dance music is unparalleled. The honours system recognises people who have either made achievements in public life or committed themselves to serving and helping Britain. We feel we can speak for fellow promoters all across the world that have had the honour of welcoming Carl to their nightclubs and festivals and have seen him deliver time and time again on both these fronts. We therefore call on all those who believe Carl should be rewarded for four decades of devoting himself to his art form and dedicating his life to spreading the sounds of UK house and techno to the four corners of the planet, by being nominated for an MBE in the 2017 New Years Honours list. This petition will close on Sunday 10th July, at which point we will nominate Carl for an MBE via the honours system. Please use this page to share your stories and memories of Carl Cox over the years and thanks for your support. South West Four x Sign the petition here http://chn.ge/28J37u6

See more recent news articles >

"We enjoy the convenience Royalty Worx offers, not only for us but also the consumer (DJ / Producer). They just click one button to get paid and don't need to send / generate a separate invoice."

Andrew Salsano - Nervous

Nervous

"Label Worx is the best promotion and label management system there is. Simple."

Pedro Delgardo - YinYang

YinYang

"Demo Worx has saved us a stack of time listening and getting back to artists! It also helps to cut out mass send outs of demos that won't be suited to our label – people actually take the time to fill in the form and the quality of demos we've seen since are of a higher quality!"

Rick Bridgman - Vicious

Vicious

"Royalty Worx is incredible, their online system is the backbone of what we do and their service is absolutely fantastic!"

Will Holland - Enhanced Music

Enhanced Music

"Here at Get Twisted we use Label Worx for a one stop shop for distribution & plugging. Label Worx is easy to navigate, making it quick to find updated feedback on future releases, as well as track current sales in real time."

Tough Love - Get Twisted

Get Twisted

"We have used Demo Worx from the day it was created by Label Worx and we are very happy with it. It's a very efficient tool that helps us listen to more than 100 demos/day. As usual, a top notch feature from the masterminds at Label Worx!"

Alex Christian - Ensis Records

Ensis Records

 

afemaudiolockchewlwamfitpaypalradarrightstertoneden